| Brand: | Abnova |
| Reference: | H00009978-A01 |
| Product name: | RBX1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant RBX1. |
| Gene id: | 9978 |
| Gene name: | RBX1 |
| Gene alias: | BA554C12.1|MGC13357|MGC1481|RNF75|ROC1 |
| Gene description: | ring-box 1 |
| Genbank accession: | BC001466 |
| Immunogen: | RBX1 (AAH01466, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |
| Protein accession: | AAH01466 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Effect of Ursolic Acid on MAPK in Cyclin D1 Signaling and RING-Type E3 Ligase (SCF E3s) in Two Endometrial Cancer Cell Lines.Achiwa Y, Hasegawa K, Udagawa Y Nutr Cancer. 2013 Oct 1. |