TREM2 polyclonal antibody View larger

TREM2 polyclonal antibody

New product

375,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TREM2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsIHC-P,IF

More info about TREM2 polyclonal antibody

Product description: Rabbit polyclonal antibody raised against partial recombinant human TREM2.
Isotype: IgG
Gene id: 54209
Gene name: TREM2
Gene alias: TREM-2|Trem2a|Trem2b|Trem2c
Gene description: triggering receptor expressed on myeloid cells 2
Immunogen: Recombinant protein corresponding to amino acids 33-144 of human TREM2.
Immunogen sequence/protein sequence: QVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFP
Protein accession: Q9NZC2
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Size: 100 uL
Shipping condition: Dry Ice

Reviews

Buy TREM2 polyclonal antibody now

Add to cart