Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TREM2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IHC-P,IF |
More info about TREM2 polyclonal antibody
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human TREM2. |
| Isotype: | IgG |
| Gene id: | 54209 |
| Gene name: | TREM2 |
| Gene alias: | TREM-2|Trem2a|Trem2b|Trem2c |
| Gene description: | triggering receptor expressed on myeloid cells 2 |
| Immunogen: | Recombinant protein corresponding to amino acids 33-144 of human TREM2. |
| Immunogen sequence/protein sequence: | QVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFP |
| Protein accession: | Q9NZC2 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1 - 4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |