FGF19 MaxPab mouse polyclonal antibody (B01) View larger

FGF19 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGF19 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FGF19 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00009965-B01
Product name: FGF19 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FGF19 protein.
Gene id: 9965
Gene name: FGF19
Gene alias: -
Gene description: fibroblast growth factor 19
Genbank accession: BC017664
Immunogen: FGF19 (AAH17664, 1 a.a. ~ 216 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Protein accession: AAH17664
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009965-B01-13-15-1.jpg
Application image note: Western Blot analysis of FGF19 expression in transfected 293T cell line (H00009965-T01) by FGF19 MaxPab polyclonal antibody.

Lane 1: FGF19 transfected lysate(23.87 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FGF19 MaxPab mouse polyclonal antibody (B01) now

Add to cart