Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF |
Brand: | Abnova |
Reference: | PAB30587 |
Product name: | LRP4 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human LRP4. |
Isotype: | IgG |
Gene id: | 4038 |
Gene name: | LRP4 |
Gene alias: | KIAA0816|LRP10|MEGF7 |
Gene description: | low density lipoprotein receptor-related protein 4 |
Immunogen: | Recombinant protein corresponding to amino acids 1757-1877 of human LRP4. |
Immunogen sequence/protein sequence: | PGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVH |
Protein accession: | O75096 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1 - 4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of human cell line U-251 MG with LRP4 polyclonal antibody (Cat # PAB30587) shows positivity in nucleus, nucleoli and cytoplasm. Antibody staining is shown in green. |
Applications: | IHC-P,IF |
Shipping condition: | Dry Ice |