Login to display prices
Login to display prices
PRPF4B monoclonal antibody (M01), clone 3E10 View larger

PRPF4B monoclonal antibody (M01), clone 3E10

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPF4B monoclonal antibody (M01), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PRPF4B monoclonal antibody (M01), clone 3E10

Reference: H00008899-M01
Product name: PRPF4B monoclonal antibody (M01), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant PRPF4B.
Clone: 3E10
Isotype: IgG2a Kappa
Gene id: 8899
Gene name: PRPF4B
Gene alias: KIAA0536|PR4H|PRP4|PRP4H|PRP4K|dJ1013A10.1
Gene description: PRP4 pre-mRNA processing factor 4 homolog B (yeast)
Genbank accession: NM_003913
Immunogen: PRPF4B (NP_003904.2, 898 a.a. ~ 1005 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Protein accession: NP_003904.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: