| Brand: | Abnova |
| Reference: | H00008899-M01 |
| Product name: | PRPF4B monoclonal antibody (M01), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPF4B. |
| Clone: | 3E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8899 |
| Gene name: | PRPF4B |
| Gene alias: | KIAA0536|PR4H|PRP4|PRP4H|PRP4K|dJ1013A10.1 |
| Gene description: | PRP4 pre-mRNA processing factor 4 homolog B (yeast) |
| Genbank accession: | NM_003913 |
| Immunogen: | PRPF4B (NP_003904.2, 898 a.a. ~ 1005 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE |
| Protein accession: | NP_003904.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PRPF4B is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Loss of cyclin-dependent kinase-like 2 predicts poor prognosis in gastric cancer, and its overexpression suppresses cells growth and invasion.Fang CL, Uen YH, Chen HK, Hseu YC, Lin CC, Hung ST, Sun DP, Lin KY. Cancer Med. 2018 May 23. [Epub ahead of print] |