| Brand: | Abnova |
| Reference: | H00065997-M01 |
| Product name: | RASL11B monoclonal antibody (M01), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RASL11B. |
| Clone: | 1B5 |
| Isotype: | IgG1 kappa |
| Gene id: | 65997 |
| Gene name: | RASL11B |
| Gene alias: | MGC2827|MGC4499 |
| Gene description: | RAS-like, family 11, member B |
| Genbank accession: | BC025694 |
| Immunogen: | RASL11B (AAH25694, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV |
| Protein accession: | AAH25694 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RASL11B monoclonal antibody (M01), clone 1B5 Western Blot analysis of RASL11B expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |