Cart 77 Product Products 25 734,46 € (empty)
No products
To be determined Shipping
25 734,46 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 77 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 734,46 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 25 734,46 €
Data sheet of USP15 monoclonal antibody (M01), clone 1C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about USP15 monoclonal antibody (M01), clone 1C10
| Brand: | Abnova |
| Reference: | H00009958-M01 |
| Product name: | USP15 monoclonal antibody (M01), clone 1C10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant USP15. |
| Clone: | 1C10 |
| Isotype: | IgG1 kappa |
| Gene id: | 9958 |
| Gene name: | USP15 |
| Gene alias: | KIAA0529|MGC131982|MGC149838|MGC74854|UNPH4 |
| Gene description: | ubiquitin specific peptidase 15 |
| Genbank accession: | BC020688 |
| Immunogen: | USP15 (AAH20688, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC |
| Protein accession: | AAH20688 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis.Xu M, Takanashi M, Oikawa K, Tanaka M, Nishi H, Isaka K, Kudo M, Kuroda M. Biochem Biophys Res Commun. 2009 Oct 16;388(2):366-71. Epub 2009 Aug 8. |