GCHFR monoclonal antibody (M01), clone 4G6 View larger

GCHFR monoclonal antibody (M01), clone 4G6

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCHFR monoclonal antibody (M01), clone 4G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about GCHFR monoclonal antibody (M01), clone 4G6

Brand: Abnova
Reference: H00002644-M01
Product name: GCHFR monoclonal antibody (M01), clone 4G6
Product description: Mouse monoclonal antibody raised against a partial recombinant GCHFR.
Clone: 4G6
Isotype: IgG2b Kappa
Gene id: 2644
Gene name: GCHFR
Gene alias: GFRP|HsT16933|MGC138467|MGC138469|P35
Gene description: GTP cyclohydrolase I feedback regulator
Genbank accession: NM_005258
Immunogen: GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Protein accession: NP_005249.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002644-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GCHFR is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Related products: - GCK monoclonal antibody (M01), clone 3C7
- GCK monoclonal antibody (M02), clone 1G10
- GCN5L2 monoclonal antibody (M01), clone 4D3
- GCN5L2 monoclonal antibody (M03), clone 4F9
- GCN5L2 monoclonal antibody (M06), clone 3F8
Shipping condition: Dry Ice

Buy GCHFR monoclonal antibody (M01), clone 4G6 now

Add to cart