Login to display prices
Login to display prices
GCHFR monoclonal antibody (M01), clone 4G6 View larger

GCHFR monoclonal antibody (M01), clone 4G6

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCHFR monoclonal antibody (M01), clone 4G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about GCHFR monoclonal antibody (M01), clone 4G6

Reference: H00002644-M01
Product name: GCHFR monoclonal antibody (M01), clone 4G6
Product description: Mouse monoclonal antibody raised against a partial recombinant GCHFR.
Clone: 4G6
Isotype: IgG2b Kappa
Gene id: 2644
Gene name: GCHFR
Gene alias: GFRP|HsT16933|MGC138467|MGC138469|P35
Gene description: GTP cyclohydrolase I feedback regulator
Genbank accession: NM_005258
Immunogen: GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Protein accession: NP_005249.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: