Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RALB monoclonal antibody (M04), clone 4D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about RALB monoclonal antibody (M04), clone 4D1
| Brand: | Abnova |
| Reference: | H00005899-M04 |
| Product name: | RALB monoclonal antibody (M04), clone 4D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RALB. |
| Clone: | 4D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5899 |
| Gene name: | RALB |
| Gene alias: | - |
| Gene description: | v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) |
| Genbank accession: | BC018163 |
| Immunogen: | RALB (AAH18163, 89 a.a. ~ 183 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE |
| Protein accession: | AAH18163 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RALB on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The mycobacterium bovis BCG phagosome proteome.Lee BY, Jethwaney D, Schilling B, Clemens DL, Gibson BW, Horwitz MA. Mol Cell Proteomics. 2009 Oct 7. [Epub ahead of print] |