Cart 42 Product Products 25 472,81 € (empty)
No products
265,00 € DAP Shipping
25 737,81 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 42 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 472,81 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 25 737,81 €
Data sheet of UBE4A monoclonal antibody (M08), clone 1G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about UBE4A monoclonal antibody (M08), clone 1G8
| Brand: | Abnova |
| Reference: | H00009354-M08 |
| Product name: | UBE4A monoclonal antibody (M08), clone 1G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE4A. |
| Clone: | 1G8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9354 |
| Gene name: | UBE4A |
| Gene alias: | E4|KIAA0126|MGC133315|UBOX2|UFD2 |
| Gene description: | ubiquitination factor E4A (UFD2 homolog, yeast) |
| Genbank accession: | NM_004788 |
| Immunogen: | UBE4A (NP_004779, 974 a.a. ~ 1073 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE |
| Protein accession: | NP_004779 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged UBE4A is approximately 3ng/ml as a capture antibody. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |