Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TM9SF2 monoclonal antibody (M12), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about TM9SF2 monoclonal antibody (M12), clone 1C2
| Brand: | Abnova |
| Reference: | H00009375-M12 |
| Product name: | TM9SF2 monoclonal antibody (M12), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TM9SF2. |
| Clone: | 1C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9375 |
| Gene name: | TM9SF2 |
| Gene alias: | FLJ26287|MGC117391|P76 |
| Gene description: | transmembrane 9 superfamily member 2 |
| Genbank accession: | NM_004800 |
| Immunogen: | TM9SF2 (NP_004791, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVDIK |
| Protein accession: | NP_004791 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TM9SF2 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |