Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of E. coli ArsR Nter FLAG and Cter His Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Escherichia coli (E. coli) |
| Host species | Escherichia coli (E. coli) |
More info about E. coli ArsR Nter FLAG and Cter His Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1071-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | E. coli ArsR Nter FLAG and Cter His Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Escherichia coli (E. coli) |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 15,33 kDa |
| Purity estimated: | 80% (DENATURED) |
| Protein accession: | ZP_03049476.1 |
| Ncbi reference: | ZP_03049476.1 |
| Aliases / synonyms: | ArsR E coli optimized, arsenical resistance operon repressor |
| Protein sequence (w/o tag): | MDYKDDDDKGSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHY RLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICSLEHHHHHH |
| Form: | liquid |
| Buffer: | PBS, 300mM in native conditions. PBS, Urea 8M, imidazole 10mM in denaturing conditions |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - A. thaliana AteIF4E1 Recombinant Protein - A. thaliana AteIF4E2 Recombinant Protein - A. thaliana AteIFiso4E Recombinant Protein |