Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of A. thaliana AteIFiso4E Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | A. thaliana |
| Host species | Escherichia coli (E. coli) |
More info about A. thaliana AteIFiso4E Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1074-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | A. thaliana AteIFiso4E Recombinant Protein |
| Fragment type: | Full-length |
| Origin species: | A. thaliana |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 24,76 kDa |
| Purity estimated: | >95% |
| Protein accession: | NP_198412.1 |
| Spec:entrez geneid: | 833534 |
| Spec:ncbi gene aliases: | EIF(ISO)4E, MJE4.8, MJE4_8, EUKARYOTIC TRANSLATION INITATION FACTOR 4E2, eIFiso4E, EIF4E2, EUKARYOTIC INITIATION FACTOR (ISO)4E, eukaryotic translation Initiation Factor isoform 4E, LOSS OF SUSCEPTIBILITY TO POTYVIRUS 1, LSP |
| Spec:swissprotid: | O04663 |
| Ncbi reference: | NP_198412.1 |
| Uniprot id: | O04663 |
| Uniprot link: | http://www.uniprot.org/uniprot/O04663 |
| Aliases / synonyms: | AteIFiso4E, translation initiation factor 4E-2 |
| Protein sequence (w/o tag): | MGSSHHHHHHSSGLVPRGSHMMATDDVNEPLPAAAELPATEAEKQPHKLERKWSFWFDNQSKKGAAWGASLRKAYTFDTVEDFWGLHETIFQTSKLTANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGWLETLMALIGEQFDEADEICGVVASVRPQSKQDKLSLWTRTKSNEAVLMGIGKKWKEILDVTDKITFNNHDDSRRSRFTV |
| Form: | liquid |
| Buffer: | PBS, imidazole 10mM, Urea 8M, pH4,2 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Mouse BRP-39 Recombinant Protein - Human BTB Recombinant Protein - Chilli Ca_eIF4E1 Recombinant Protein |