Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of A. thaliana AteIF4E2 Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | A. thaliana |
| Host species | Escherichia coli (E. coli) |
More info about A. thaliana AteIF4E2 Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1073-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | A. thaliana AteIF4E2 Recombinant Protein |
| Fragment type: | Full-length |
| Origin species: | A. thaliana |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 29,79 kDa |
| Purity estimated: | 0.75 |
| Protein accession: | NP_174252.1 |
| Spec:entrez geneid: | 839836 |
| Spec:ncbi gene aliases: | F15D2_16, F15D2.16, eukaryotic translation Initiation Factor 4E3 |
| Spec:swissprotid: | Q9C7P2 |
| Ncbi reference: | NP_174252.1 |
| Uniprot id: | Q9C7P2 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q9C7P2 |
| Aliases / synonyms: | AteIF4E2, Translation initiation factor eIF-4E |
| Protein sequence (w/o tag): | MGSSHHHHHHSSGLVPRGSHMLEMVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKS TTVIQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPI CANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYND TIGFIVHEDAKTLDRDAKRRYTV |
| Form: | liquid |
| Buffer: | PBS, Urea 8M, pH4 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - A. thaliana AteIFiso4E Recombinant Protein - Mouse BRP-39 Recombinant Protein - Human BTB Recombinant Protein |