Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of A. thaliana AteIF4E1 Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | A. thaliana |
| Host species | Escherichia coli (E. coli) |
More info about A. thaliana AteIF4E1 Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1072-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | A. thaliana AteIF4E1 Recombinant Protein |
| Fragment type: | Full-length |
| Origin species: | A. thaliana |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 28,76 kDa |
| Purity estimated: | >90% |
| Protein accession: | NP_193538.1 |
| Spec:entrez geneid: | 827529 |
| Spec:ncbi gene aliases: | AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1 |
| Spec:swissprotid: | O23252 |
| Ncbi reference: | NP_193538.1 |
| Uniprot id: | O23252 |
| Uniprot link: | http://www.uniprot.org/uniprot/O23252 |
| Aliases / synonyms: | AteIF4E1, translation initiation factor eIF-4E |
| Protein sequence (w/o tag): | MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA |
| Form: | liquid |
| Buffer: | PBS, imidazole 300mM, pH7,4 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - A. thaliana AteIF4E2 Recombinant Protein - A. thaliana AteIFiso4E Recombinant Protein - Mouse BRP-39 Recombinant Protein |