Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPL39L monoclonal antibody (M01), clone 4A8-1B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about RPL39L monoclonal antibody (M01), clone 4A8-1B6
| Brand: | Abnova |
| Reference: | H00116832-M01 |
| Product name: | RPL39L monoclonal antibody (M01), clone 4A8-1B6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RPL39L. |
| Clone: | 4A8-1B6 |
| Isotype: | IgG1 kappa |
| Gene id: | 116832 |
| Gene name: | RPL39L |
| Gene alias: | RPL39L1 |
| Gene description: | ribosomal protein L39-like |
| Genbank accession: | BC012328 |
| Immunogen: | RPL39L (AAH12328, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL |
| Protein accession: | AAH12328 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |