Brand: | Abnova |
Reference: | H00003117-M01 |
Product name: | HLA-DQA1 monoclonal antibody (M01), clone 1A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HLA-DQA1. |
Clone: | 1A3 |
Isotype: | IgG2a Kappa |
Gene id: | 3117 |
Gene name: | HLA-DQA1 |
Gene alias: | CD|CELIAC1|DQ-A1|FLJ27088|FLJ27328|GSE|HLA-DQA|MGC149527 |
Gene description: | major histocompatibility complex, class II, DQ alpha 1 |
Genbank accession: | NM_002122 |
Immunogen: | HLA-DQA1 (NP_002113.2, 24 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN |
Protein accession: | NP_002113.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and anti-HLA-DQA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |