Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTK6 monoclonal antibody (M01), clone 2F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA |
More info about PTK6 monoclonal antibody (M01), clone 2F11
| Brand: | Abnova |
| Reference: | H00005753-M01 |
| Product name: | PTK6 monoclonal antibody (M01), clone 2F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTK6. |
| Clone: | 2F11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5753 |
| Gene name: | PTK6 |
| Gene alias: | BRK|FLJ42088 |
| Gene description: | PTK6 protein tyrosine kinase 6 |
| Genbank accession: | NM_005975 |
| Immunogen: | PTK6 (NP_005966, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT |
| Protein accession: | NP_005966 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged PTK6 is approximately 10ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Olive Phenolics as c-Met Inhibitors: (-)-Oleocanthal Attenuates Cell Proliferation, Invasiveness, and Tumor Growth in Breast Cancer Models.Akl MR, Ayoub NM, Mohyeldin MM, Busnena BA, Foudah AI, Liu YY, Sayed KA PLoS One. 2014 May 21;9(5):e97622. doi: 10.1371/journal.pone.0097622. eCollection 2014. |