HLA-DQB2 purified MaxPab mouse polyclonal antibody (B01P) View larger

HLA-DQB2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HLA-DQB2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HLA-DQB2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003120-B01P
Product name: HLA-DQB2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HLA-DQB2 protein.
Gene id: 3120
Gene name: HLA-DQB2
Gene alias: HLA-DQB1|HLA-DXB
Gene description: major histocompatibility complex, class II, DQ beta 2
Genbank accession: NM_182549
Immunogen: HLA-DQB2 (NP_872355.1, 1 a.a. ~ 231 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
Protein accession: NP_872355.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003120-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HLA-DQB2 expression in transfected 293T cell line (H00003120-T01) by HLA-DQB2 MaxPab polyclonal antibody.

Lane 1: HLA-DQB2 transfected lysate(26.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HLA-DQB2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart