| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00116225-B01P |
| Product name: | ZMYND19 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZMYND19 protein. |
| Gene id: | 116225 |
| Gene name: | ZMYND19 |
| Gene alias: | MIZIP|RP11-48C7.4 |
| Gene description: | zinc finger, MYND-type containing 19 |
| Genbank accession: | NM_138462 |
| Immunogen: | ZMYND19 (NP_612471, 1 a.a. ~ 227 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER |
| Protein accession: | NP_612471 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ZMYND19 expression in transfected 293T cell line by ZMYND19 MaxPab polyclonal antibody. Lane 1: ZMYND19 transfected lysate(24.97 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |