| Brand: | Abnova |
| Reference: | H00006421-M02 |
| Product name: | SFPQ monoclonal antibody (M02), clone 6D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SFPQ. |
| Clone: | 6D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6421 |
| Gene name: | SFPQ |
| Gene alias: | POMP100|PSF |
| Gene description: | splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated) |
| Genbank accession: | NM_005066 |
| Immunogen: | SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ |
| Protein accession: | NP_005057 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SFPQ on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Combinatorial Control of Signal-Induced Exon Repression by HnRNP L and PSF.Melton AA, Jackson J, Wang J, Lynch KW. Mol Cell Biol. 2007 Oct;27(19):6972-84. Epub 2007 Jul 30. |