RUNX2 monoclonal antibody (M24), clone 4B4 View larger

RUNX2 monoclonal antibody (M24), clone 4B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX2 monoclonal antibody (M24), clone 4B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RUNX2 monoclonal antibody (M24), clone 4B4

Brand: Abnova
Reference: H00000860-M24
Product name: RUNX2 monoclonal antibody (M24), clone 4B4
Product description: Mouse monoclonal antibody raised against a full length recombinant RUNX2.
Clone: 4B4
Isotype: IgG2b Kappa
Gene id: 860
Gene name: RUNX2
Gene alias: AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1
Gene description: runt-related transcription factor 2
Genbank accession: NM_001024630
Immunogen: RUNX2 (NP_001019801.1, 311 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS
Protein accession: NP_001019801.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000860-M24-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000860-M24-1-21-1.jpg
Application image note: RUNX2 monoclonal antibody (M24), clone 4B4 Western Blot analysis of RUNX2 expression in LNCaP ( Cat # L004V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RUNX2 monoclonal antibody (M24), clone 4B4 now

Add to cart