Brand: | Abnova |
Reference: | H00006124-M01 |
Product name: | RPL4 monoclonal antibody (M01), clone 4A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPL4. |
Clone: | 4A3 |
Isotype: | IgG2a Kappa |
Gene id: | 6124 |
Gene name: | RPL4 |
Gene alias: | - |
Gene description: | ribosomal protein L4 |
Genbank accession: | NM_000968 |
Immunogen: | RPL4 (NP_000959, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR |
Protein accession: | NP_000959 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Shwachman-Bodian Diamond syndrome is a multi-functional protein implicated in cellular stress responses.Ball HL, Zhang B, Riches JJ, Gandhi R, Li J, Rommens JM, Myers JS. Hum Mol Genet. 2009 Oct 1;18(19):3684-95. Epub 2009 Jul 14. |