Brand: | Abnova |
Reference: | H00006256-M17 |
Product name: | RXRA monoclonal antibody (M17), clone 1G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RXRA. |
Clone: | 1G1 |
Isotype: | IgG2a Kappa |
Gene id: | 6256 |
Gene name: | RXRA |
Gene alias: | FLJ00280|FLJ00318|FLJ16020|FLJ16733|MGC102720|NR2B1 |
Gene description: | retinoid X receptor, alpha |
Genbank accession: | NM_002957 |
Immunogen: | RXRA (NP_002948, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPP |
Protein accession: | NP_002948 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of RXRA transfected lysate using anti-RXRA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RXRA MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |