No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00006256-M17 |
| Product name: | RXRA monoclonal antibody (M17), clone 1G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RXRA. |
| Clone: | 1G1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6256 |
| Gene name: | RXRA |
| Gene alias: | FLJ00280|FLJ00318|FLJ16020|FLJ16733|MGC102720|NR2B1 |
| Gene description: | retinoid X receptor, alpha |
| Genbank accession: | NM_002957 |
| Immunogen: | RXRA (NP_002948, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPP |
| Protein accession: | NP_002948 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoprecipitation of RXRA transfected lysate using anti-RXRA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RXRA MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |