| Brand:  | Abnova | 
| Reference:  | H00004798-M03 | 
| Product name:  | NFRKB monoclonal antibody (M03), clone 3G8 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant NFRKB. | 
| Clone:  | 3G8 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 4798 | 
| Gene name:  | NFRKB | 
| Gene alias:  | DKFZp547B2013|INO80G | 
| Gene description:  | nuclear factor related to kappaB binding protein | 
| Genbank accession:  | NM_006165 | 
| Immunogen:  | NFRKB (NP_006156, 90 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | FPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEVVKYRQLCFKSQYKRYLNSQQQYFHRLLKQILASRSDLLEMARRSGPALPFRQKRPSPSRTPEER | 
| Protein accession:  | NP_006156 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |