Brand: | Abnova |
Reference: | H00002100-M01 |
Product name: | ESR2 monoclonal antibody (M01), clone 3F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ESR2. |
Clone: | 3F3 |
Isotype: | IgG2b Kappa |
Gene id: | 2100 |
Gene name: | ESR2 |
Gene alias: | ER-BETA|ESR-BETA|ESRB|ESTRB|Erb|NR3A2 |
Gene description: | estrogen receptor 2 (ER beta) |
Genbank accession: | NM_001437 |
Immunogen: | ESR2 (NP_001428, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNR |
Protein accession: | NP_001428 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ESR2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Neonatal exposure to 17β-estradiol down-regulates the expression of synaptogenesis related genes in selected brain regions of adult female rats.Radhika NS, Govindaraj V, Sarangi SK, Rao AJ. Life Sci. 2015 Sep 24. |