Cart 8 Product Products 16 368,67 € (empty)
No products
To be determined Shipping
16 368,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 368,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 368,67 €
Data sheet of KCNE1 monoclonal antibody (M13), clone 2A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,IP |
More info about KCNE1 monoclonal antibody (M13), clone 2A6
| Brand: | Abnova |
| Reference: | H00003753-M13 |
| Product name: | KCNE1 monoclonal antibody (M13), clone 2A6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant KCNE1. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3753 |
| Gene name: | KCNE1 |
| Gene alias: | FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK |
| Gene description: | potassium voltage-gated channel, Isk-related family, member 1 |
| Genbank accession: | BC036452 |
| Immunogen: | KCNE1 (AAH36452, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS |
| Protein accession: | AAH36452 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |