| Brand: | Abnova |
| Reference: | H00010563-D01 |
| Product name: | CXCL13 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CXCL13 protein. |
| Gene id: | 10563 |
| Gene name: | CXCL13 |
| Gene alias: | ANGIE|ANGIE2|BCA-1|BCA1|BLC|BLR1L|SCYB13 |
| Gene description: | chemokine (C-X-C motif) ligand 13 |
| Genbank accession: | NM_006419 |
| Immunogen: | CXCL13 (NP_006410.1, 1 a.a. ~ 109 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
| Protein accession: | NP_006410.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of CXCL13 transfected lysate using anti-CXCL13 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CXCL13 MaxPab mouse polyclonal antibody (B02) (H00010563-B02). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |