Brand: | Abnova |
Reference: | H00000873-M01 |
Product name: | CBR1 monoclonal antibody (M01), clone 4G11-1C7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CBR1. |
Clone: | 4G11-1C7 |
Isotype: | IgG2a Kappa |
Gene id: | 873 |
Gene name: | CBR1 |
Gene alias: | CBR|SDR21C1|hCBR1 |
Gene description: | carbonyl reductase 1 |
Genbank accession: | BC002511 |
Immunogen: | CBR1 (AAH02511.1, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Protein accession: | AAH02511.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (56.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CBR1 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Two non-synonymous single nucleotide polymorphisms of human carbonyl reductase 1 demonstrate reduced in vitro metabolism of daunorubicin and doxorubicin.Bains OS, Karkling MJ, Grigliatti TA, Reid RE, Riggs KW. Drug Metab Dispos. 2009 May;37(5):1107-14. Epub 2009 Feb 9. |