Cart 25 Product Products 10 426,50 € (empty)
-
-
-
-
1 x Mouse Ig...179,00 € -
-
-
-
-
-
-
1 x Feline...319,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Visfatin...694,00 €
No products
To be determined Shipping
10 426,50 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 25 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 426,50 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 426,50 €
Data sheet of CBR1 monoclonal antibody (M01), clone 4G11-1C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CBR1 monoclonal antibody (M01), clone 4G11-1C7
| Brand: | Abnova |
| Reference: | H00000873-M01 |
| Product name: | CBR1 monoclonal antibody (M01), clone 4G11-1C7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CBR1. |
| Clone: | 4G11-1C7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 873 |
| Gene name: | CBR1 |
| Gene alias: | CBR|SDR21C1|hCBR1 |
| Gene description: | carbonyl reductase 1 |
| Genbank accession: | BC002511 |
| Immunogen: | CBR1 (AAH02511.1, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
| Protein accession: | AAH02511.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (56.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CBR1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Two non-synonymous single nucleotide polymorphisms of human carbonyl reductase 1 demonstrate reduced in vitro metabolism of daunorubicin and doxorubicin.Bains OS, Karkling MJ, Grigliatti TA, Reid RE, Riggs KW. Drug Metab Dispos. 2009 May;37(5):1107-14. Epub 2009 Feb 9. |