Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RUNX1 monoclonal antibody (M01), clone 3A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA |
More info about RUNX1 monoclonal antibody (M01), clone 3A8
| Brand: | Abnova |
| Reference: | H00000861-M01 |
| Product name: | RUNX1 monoclonal antibody (M01), clone 3A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RUNX1. |
| Clone: | 3A8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 861 |
| Gene name: | RUNX1 |
| Gene alias: | AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB |
| Gene description: | runt-related transcription factor 1 |
| Genbank accession: | NM_001001890 |
| Immunogen: | RUNX1 (NP_001001890.1, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP |
| Protein accession: | NP_001001890.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml] |
| Applications: | IHC-P,IF,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | The RUNX1 transcription factor is expressed in serous epithelial ovarian carcinoma and contributes to cell proliferation, migration and invasion.Keita M, Bachvarova M, Morin C, Plante M, Gregoire J, Renaud MC, Sebastianelli A, Trinh XB, Bachvarov D Cell Cycle. 2013 Feb 26;12(6). |