No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000087-M01 |
| Product name: | ACTN1 monoclonal antibody (M01), clone 3F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACTN1. |
| Clone: | 3F1 |
| Isotype: | IgG3 Kappa |
| Gene id: | 87 |
| Gene name: | ACTN1 |
| Gene alias: | FLJ40884 |
| Gene description: | actinin, alpha 1 |
| Genbank accession: | NM_001102 |
| Immunogen: | ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA |
| Protein accession: | NP_001093 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ACTN1 expression in transfected 293T cell line by ACTN1 monoclonal antibody (M01), clone 3F1. Lane 1: ACTN1 transfected lysate(103.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Rab13 Small G Protein and Junctional Rab13-binding Protein (JRAB) Orchestrate Actin Cytoskeletal Organization during Epithelial Junctional Development.Sakane A, Abdallah AA, Nakano K, Honda K, Ikeda W, Nishikawa Y, Matsumoto M, Matsushita N, Kitamura T, Sasaki T. J Biol Chem. 2012 Dec 14;287(51):42455-68. doi: 10.1074/jbc.M112.383653. Epub 2012 Oct 24. |