Cart 1 Product Products 256,00 € (empty)
No products
To be determined Shipping
256,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 256,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 256,00 €
Data sheet of BLK monoclonal antibody (M02), clone 7A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BLK monoclonal antibody (M02), clone 7A12
| Brand: | Abnova |
| Reference: | H00000640-M02 |
| Product name: | BLK monoclonal antibody (M02), clone 7A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BLK. |
| Clone: | 7A12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 640 |
| Gene name: | BLK |
| Gene alias: | MGC10442 |
| Gene description: | B lymphoid tyrosine kinase |
| Genbank accession: | BC007371 |
| Immunogen: | BLK (AAH07371, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG |
| Protein accession: | AAH07371 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | BLK monoclonal antibody (M02), clone 7A12. Western Blot analysis of BLK expression in Raw 264.7. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | BANK1 and BLK Act through Phospholipase C Gamma 2 in B-Cell Signaling.Bernal-Quiros M, Wu YY, Alarcon-Riquelme ME, Castillejo-Lopez C PLoS One. 2013;8(3):e59842. doi: 10.1371/journal.pone.0059842. Epub 2013 Mar 26. |