| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10A. |
| Clone: | 4B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8797 |
| Gene name: | TNFRSF10A |
| Gene alias: | APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1 |
| Gene description: | tumor necrosis factor receptor superfamily, member 10a |
| Genbank accession: | BC012866.1 |
| Immunogen: | TNFRSF10A (AAH12866.1, 103 a.a. ~ 239 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN |
| Protein accession: | AAH12866.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |