No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | ELISA |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10A. |
Clone: | 4B8 |
Isotype: | IgG1 Kappa |
Gene id: | 8797 |
Gene name: | TNFRSF10A |
Gene alias: | APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1 |
Gene description: | tumor necrosis factor receptor superfamily, member 10a |
Genbank accession: | BC012866.1 |
Immunogen: | TNFRSF10A (AAH12866.1, 103 a.a. ~ 239 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN |
Protein accession: | AAH12866.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Size: | 100 ug |
Shipping condition: | Dry Ice |