View larger

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Reference:

Condition: New product

Data sheet of Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Brand:	ProteoGenix
Proteogenix reference:	PX-P4045-10
Protein delivered with tag?:	Yes
Size:	10 ug
Product name:	Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
Fragment type:	Partial
Origin species:	Human
Expression system:	Eukaryotic expression
Host species:	Mammalian
Molecular weight with tag if any:	28.73kDa
Purity estimated:	70%
Uniprot id:	Q7Z7D3
Uniprot link:	http://www.uniprot.org/uniprot/Q7Z7D3
Aliases / synonyms:	B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Protein sequence (w/o tag):	MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Form:	Lyophilized
Buffer:	PBS, pH 7.5
Storage condition:	4Â°C for short term (1 week), -20Â°C or -80Â°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition:	any condition
Delivery lead time in business days:	5-7
Related products:	- Human CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein - Human BNP peptide/Natriuretic peptides B - Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein