No products
Prices are tax excluded
New product
Availability date:
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4045-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Eukaryotic expression |
| Host species: | Mammalian |
| Molecular weight with tag if any: | 28.73kDa |
| Purity estimated: | 70% |
| Uniprot id: | Q7Z7D3 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q7Z7D3 |
| Aliases / synonyms: | B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1 |
| Protein sequence (w/o tag): | MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH |
| Form: | Lyophilized |
| Buffer: | PBS, pH 7.5 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |
| Related products: | - Human CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein - Human BNP peptide/Natriuretic peptides B - Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein |