No products
Prices are tax excluded
New product
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P4047-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human BNP peptide/Natriuretic peptides B |
Fragment type: | Partial |
Origin species: | Human |
Expression system: | Prokaryotic expression |
Host species: | Escherichia coli (E. coli) |
Molecular weight with tag if any: | 28.85kDa |
Purity estimated: | 85% |
Uniprot id: | P16860 |
Uniprot link: | http://www.uniprot.org/uniprot/P16860 |
Aliases / synonyms: | NT-PROBNP, BNP, Natriuretic peptide B, GC-B, B-Type Natriuretic Peptide, Ventricular Natriuretic Peptide, Gamma-brain natriuretic peptide, Brain natriuretic peptide 32 |
Protein sequence (w/o tag): | MGSHHHHHHSGHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
Form: | Lyophilized |
Buffer: | 50 mM Tris-HCl pH 8, 150 mM NaCl |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | any condition |
Delivery lead time in business days: | 5-7 |
Related products: | - Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein - Human Galectin-1 (GAL1) recombinant protein - Human Galectin3 (GAL3) recombinant protein |
Image: | ![]() |