Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human Galectin3 (GAL3) recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human Galectin3 (GAL3) recombinant protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4050-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human Galectin3 (GAL3) recombinant protein |
| Fragment type: | Full-length |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 27.17kDa |
| Purity estimated: | 80% |
| Uniprot id: | P17931 |
| Uniprot link: | http://www.uniprot.org/uniprot/P17931 |
| Aliases / synonyms: | LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29 |
| Protein sequence (w/o tag): | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMILEHHHHHH |
| Form: | Lyophilized |
| Buffer: | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |
| Related products: | - Human Golgi membrane protein 1 (GP73) recombinant protein - Human SIRT1 recombinant protein - Human CKMB recombinant protein |
| Image: |  |