FAM83H polyclonal antibody View larger

FAM83H polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM83H polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FAM83H polyclonal antibody

Brand: Abnova
Reference: PAB21719
Product name: FAM83H polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM83H.
Isotype: IgG
Gene id: 286077
Gene name: FAM83H
Gene alias: AI3|FLJ46072
Gene description: family with sequence similarity 83, member H
Immunogen: Recombinant protein corresponding to amino acids of human FAM83H.
Immunogen sequence/protein sequence: VVSQAWREEVAAPGAVGGERRSLESCLLDLRDSFAQQLHQEAERQPGAASLTAAQLLDTLGRSGSDRLPSRFLSAQSHSTSPQGLDSPLPLEGS
Protein accession: Q6ZRV2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21719-48-307-1.jpg
Application image note: Immunohistochemical staining of human vagina with FAM83H polyclonal antibody (Cat # PAB21719) shows strong cytoplasmic and nuclear positivity in squamous epithelial cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAM83H polyclonal antibody now

Add to cart