Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 385,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 385,00 €
Data sheet of KPNA1 polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about KPNA1 polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00003836-A02 |
| Product name: | KPNA1 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant KPNA1. |
| Gene id: | 3836 |
| Gene name: | KPNA1 |
| Gene alias: | IPOA5|NPI-1|RCH2|SRP1 |
| Gene description: | karyopherin alpha 1 (importin alpha 5) |
| Genbank accession: | BC002374 |
| Immunogen: | KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL |
| Protein accession: | AAH02374.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (85.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | KPNA1 polyclonal antibody (A02), Lot # 061025JCS1 Western Blot analysis of KPNA1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Nuclear localization of endogenous RGK proteins and modulation of cell shape remodeling by regulated nuclear transport.Mahalakshmi RN, Ng MY, Guo K, Qi Z, Hunziker W, Beguin P. Traffic. 2007 Sep;8(9):1164-78. Epub 2007 Jul 1. |