No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA |
Brand: | Abnova |
Reference: | H00057476-A01 |
Product name: | KIAA1201 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KIAA1201. |
Gene id: | 57476 |
Gene name: | GRAMD1B |
Gene alias: | KIAA1201|MGC125622|MGC125623|MGC125625 |
Gene description: | GRAM domain containing 1B |
Genbank accession: | XM_370660 |
Immunogen: | KIAA1201 (XP_370660, 250 a.a. ~ 353 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNE |
Protein accession: | XP_370660 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | KIAA1201 polyclonal antibody (A01), Lot # 050914JCO1 Western Blot analysis of GRAMD1B expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |