View larger

HSD17B12 monoclonal antibody (M08), clone 4G11

Reference:

Condition: New product

Data sheet of HSD17B12 monoclonal antibody (M08), clone 4G11

Brand:	Abnova
Reference:	H00051144-M08
Product name:	HSD17B12 monoclonal antibody (M08), clone 4G11
Product description:	Mouse monoclonal antibody raised against a partial recombinant HSD17B12.
Clone:	4G11
Isotype:	IgG2b Kappa
Gene id:	51144
Gene name:	HSD17B12
Gene alias:	KAR\|SDR12C1
Gene description:	hydroxysteroid (17-beta) dehydrogenase 12
Genbank accession:	NM_016142
Immunogen:	HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Protein accession:	NP_057226
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse,Rat
Application image:
Application image note:	HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in Jurkat(Cat # L017V1 ).
Applications:	WB-Ce,WB-Ti,S-ELISA,ELISA
Shipping condition:	Dry Ice