| Brand:  | Abnova | 
| Reference:  | H00005859-M01 | 
| Product name:  | QARS monoclonal antibody (M01), clone 5F5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant QARS. | 
| Clone:  | 5F5 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 5859 | 
| Gene name:  | QARS | 
| Gene alias:  | GLNRS|PRO2195 | 
| Gene description:  | glutaminyl-tRNA synthetase | 
| Genbank accession:  | NM_005051 | 
| Immunogen:  | QARS (NP_005042, 677 a.a. ~ 775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV | 
| Protein accession:  | NP_005042 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L. Neoplasia. 2009 Nov;11(11):1194-207. |