No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00005859-M01 |
Product name: | QARS monoclonal antibody (M01), clone 5F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant QARS. |
Clone: | 5F5 |
Isotype: | IgG2b Kappa |
Gene id: | 5859 |
Gene name: | QARS |
Gene alias: | GLNRS|PRO2195 |
Gene description: | glutaminyl-tRNA synthetase |
Genbank accession: | NM_005051 |
Immunogen: | QARS (NP_005042, 677 a.a. ~ 775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV |
Protein accession: | NP_005042 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L. Neoplasia. 2009 Nov;11(11):1194-207. |