CHRNA5 monoclonal antibody (M01), clone 7D3 View larger

CHRNA5 monoclonal antibody (M01), clone 7D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNA5 monoclonal antibody (M01), clone 7D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CHRNA5 monoclonal antibody (M01), clone 7D3

Brand: Abnova
Reference: H00001138-M01
Product name: CHRNA5 monoclonal antibody (M01), clone 7D3
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNA5.
Clone: 7D3
Isotype: IgG1 Kappa
Gene id: 1138
Gene name: CHRNA5
Gene alias: LNCR2
Gene description: cholinergic receptor, nicotinic, alpha 5
Genbank accession: NM_000745
Immunogen: CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Protein accession: NP_000736
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001138-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001138-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CHRNA5 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CHRNA5 monoclonal antibody (M01), clone 7D3 now

Add to cart