| Brand: | Abnova |
| Reference: | H00026468-M02 |
| Product name: | LHX6 monoclonal antibody (M02), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX6. |
| Clone: | 1B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26468 |
| Gene name: | LHX6 |
| Gene alias: | LHX6.1|MGC119542|MGC119544|MGC119545 |
| Gene description: | LIM homeobox 6 |
| Genbank accession: | NM_014368 |
| Immunogen: | LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY |
| Protein accession: | NP_055183 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to LHX6 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |