| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00026353-M04 |
| Product name: | HSPB8 monoclonal antibody (M04), clone 5B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSPB8. |
| Clone: | 5B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26353 |
| Gene name: | HSPB8 |
| Gene alias: | CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22 |
| Gene description: | heat shock 22kDa protein 8 |
| Genbank accession: | NM_014365 |
| Immunogen: | HSPB8 (NP_055180, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
| Protein accession: | NP_055180 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M04), clone 5B12. Lane 1: HSPB8 transfected lysate(35.446 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Modulation of Protein Quality Control and Proteasome to Autophagy Switch in Immortalized Myoblasts from Duchenne Muscular Dystrophy Patients.Wattin M, Gaweda L, Muller P, Baritaud M, Scholtes C, Lozano C, Gieseler K, Kretz-Remy C. Int J Mol Sci. 2018 Jan 7;19(1). pii: E178. |