| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00010344-D01P |
| Product name: | CCL26 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CCL26 protein. |
| Gene id: | 10344 |
| Gene name: | CCL26 |
| Gene alias: | IMAC|MGC126714|MIP-4a|MIP-4alpha|SCYA26|TSC-1 |
| Gene description: | chemokine (C-C motif) ligand 26 |
| Genbank accession: | NM_006072 |
| Immunogen: | CCL26 (NP_006063.1, 1 a.a. ~ 94 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
| Protein accession: | NP_006063.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CCL26 expression in transfected 293T cell line (H00010344-T01) by CCL26 MaxPab polyclonal antibody. Lane 1: CCL26 transfected lysate(10.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |