View larger

CD72 monoclonal antibody (M03), clone 4D10

Reference:

Condition: New product

Data sheet of CD72 monoclonal antibody (M03), clone 4D10

Brand:	Abnova
Reference:	H00000971-M03
Product name:	CD72 monoclonal antibody (M03), clone 4D10
Product description:	Mouse monoclonal antibody raised against a partial recombinant CD72.
Clone:	4D10
Isotype:	IgG1 Kappa
Gene id:	971
Gene name:	CD72
Gene alias:	CD72b\|LYB2
Gene description:	CD72 molecule
Genbank accession:	NM_001782
Immunogen:	CD72 (NP_001773.1, 117 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC
Protein accession:	NP_001773.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.84 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged CD72 is 0.03 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice