Cart 4 Product Products 779,59 € (empty)
No products
To be determined Shipping
779,59 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 779,59 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 779,59 €
Data sheet of PCGF3 monoclonal antibody (M03), clone 1F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA |
More info about PCGF3 monoclonal antibody (M03), clone 1F1
| Brand: | Abnova |
| Reference: | H00010336-M03 |
| Product name: | PCGF3 monoclonal antibody (M03), clone 1F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCGF3. |
| Clone: | 1F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10336 |
| Gene name: | PCGF3 |
| Gene alias: | DKFZp686D20235|DONG1|FLJ36550|FLJ43813|MGC129615|MGC40413|RNF3|RNF3A |
| Gene description: | polycomb group ring finger 3 |
| Genbank accession: | NM_006315 |
| Immunogen: | PCGF3 (NP_006306, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL |
| Protein accession: | NP_006306 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PCGF3 is approximately 3ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |