| Brand: | Abnova |
| Reference: | H00006615-M41 |
| Product name: | SNAI1 monoclonal antibody (M41), clone 1A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAI1. |
| Clone: | 1A5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6615 |
| Gene name: | SNAI1 |
| Gene alias: | SLUGH2|SNA|SNAH|dJ710H13.1 |
| Gene description: | snail homolog 1 (Drosophila) |
| Genbank accession: | NM_005985 |
| Immunogen: | SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH |
| Protein accession: | NP_005976.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SNAI1 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr,IP |
| Shipping condition: | Dry Ice |