Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of USP34 monoclonal antibody (M01), clone 2E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about USP34 monoclonal antibody (M01), clone 2E2
| Brand: | Abnova |
| Reference: | H00009736-M01 |
| Product name: | USP34 monoclonal antibody (M01), clone 2E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant USP34. |
| Clone: | 2E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9736 |
| Gene name: | USP34 |
| Gene alias: | FLJ43910|KIAA0570|KIAA0729|MGC104459 |
| Gene description: | ubiquitin specific peptidase 34 |
| Genbank accession: | NM_014709 |
| Immunogen: | USP34 (NP_055524, 3296 a.a. ~ 3395 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS |
| Protein accession: | NP_055524 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to USP34 on formalin-fixed paraffin-embedded human seminoma. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.Sy SM, Jiang J, O WS, Deng Y, Huen MS Nucleic Acids Res. 2013 Jul 17. |