No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00006431-M02 | 
| Product name: | SFRS6 monoclonal antibody (M02), clone 5G6 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SFRS6. | 
| Clone: | 5G6 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 6431 | 
| Gene name: | SFRS6 | 
| Gene alias: | B52|FLJ08061|MGC5045|SRP55 | 
| Gene description: | splicing factor, arginine/serine-rich 6 | 
| Genbank accession: | NM_006275 | 
| Immunogen: | SFRS6 (NP_006266, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR | 
| Protein accession: | NP_006266 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Detection limit for recombinant GST tagged SFRS6 is approximately 0.3ng/ml as a capture antibody. | 
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |